Web Analysis for Walmsleyapplianceservices - walmsleyapplianceservices.site
Welcome to Walmsley Appliance Services. All brands of electrical home appliances repaired Tel: 098 28814 For appliance repairs and shower repairs accross Mayo
2.92
Rating by CuteStat
It is a domain having site extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, walmsleyapplianceservices.site is SAFE to browse.
PageSpeed Score
75
Siteadvisor Rating
Not Applicable
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 7 |
H3 Headings: | 5 | H4 Headings: | Not Applicable |
H5 Headings: | 4 | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 13 |
Google Adsense: | Not Applicable | Google Analytics: | UA-9949038-1 |
Websites Hosted on Same IP (i.e. 104.248.233.180)
Rathfarnham Appliance Repairs | Boiler Repairs | Dublin
- rathfarnhamappliances.site
Rathfarnham Appliance Repairs specialise in all domestic appliance repairs based in Dublin. Call us today.
Not Applicable
$
8.95
Auto Repair Tucson | Mechanic Arizona | Car Repair 85751- Milex Auto S
- milexauto.site
Milex Auto Repair Services offers a multitude of services to keep your car in the best possible condition. Call us and schedule an appointment today!
Not Applicable
$
8.95
HTTP Header Analysis
HTTP/1.1 200 OK
Server: nginx
Date: Sat, 29 Sep 2018 00:49:47 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Last-Modified: Thu, 27 Sep 2018 21:50:15 GMT
ETag: W/"b484-576e152f413c0"
Content-Encoding: gzip
Server: nginx
Date: Sat, 29 Sep 2018 00:49:47 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Last-Modified: Thu, 27 Sep 2018 21:50:15 GMT
ETag: W/"b484-576e152f413c0"
Content-Encoding: gzip
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
walmsleyapplianceservices.site | A | 3588 |
IP: 104.248.233.180 |
walmsleyapplianceservices.site | NS | 1800 |
Target: ns2.digitalocean.com |
walmsleyapplianceservices.site | NS | 1800 |
Target: ns3.digitalocean.com |
walmsleyapplianceservices.site | NS | 1800 |
Target: ns1.digitalocean.com |
walmsleyapplianceservices.site | SOA | 1800 |
MNAME: ns1.digitalocean.com RNAME: hostmaster.walmsleyapplianceservices.site Serial: 1538098157 Refresh: 10800 Retry: 3600 Expire: 604800 Minimum TTL: 1800 |